CG Labz
Peptide Library / Immune / Recovery

VIP

Vasoactive Intestinal Peptide

VIP (Vasoactive Intestinal Peptide) Research Protocol

Complete Research Guide 4 min read1 peer-reviewed references

Quickstart Overview

VIP is a 28-amino-acid neuropeptide with broad anti-inflammatory, vasodilatory and immune-balancing activity. It is best known in research protocols for chronic inflammatory response syndrome (CIRS) and is typically administered intranasally.

Reconstitution
Reconstitute per product form; transfer to a metered nasal sprayer
Literature Range
~50 mcg per actuation
Measuring Reference
Metered sprayer dosing
Frequency
1–4× daily
Route (studies)
Intranasal
Focus
CIRS / anti-inflammatory

Scientific Data

Molecular Formula
—
Molecular Weight
3326.8 Da
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence Length
30
CAS
Research compound
Peptide Family
Neuropeptide
Half-life
Refer to published literature
Solubility
Bacteriostatic water, sterile saline
Storage
Lyophilized: -20°C. Reconstituted: 2–8°C, use within 2–4 weeks.
Appearance
White lyophilized powder
Standard: 10 mg vial · 2 mL diluent

Dosing & Reconstitution Guide

Interactive Reconstitution
Adjust vial size, diluent and target dose. Results update live.
Full Precision Calculator →
Concentration
5.00 mg/mL
Draw Volume
0.010 mL
Syringe Units
1.0 U
Doses / Vial
200

Units assume a U-100 insulin syringe (100 units = 1 mL). Administered intranasally in most protocols; start low to assess blood-pressure response.

Frequency: 1–4× daily (intranasal)

Reconstitution Steps

  1. 1Allow the lyophilized vial and bacteriostatic water to reach room temperature (~15 min).
  2. 2Swab both vial stoppers with a fresh 70% isopropyl alcohol pad and let them dry.
  3. 3Draw 2.0 mL of bacteriostatic water into a mixing syringe.
  4. 4Insert at an angle and let the water run slowly down the glass wall — never directly onto the powder.
  5. 5Gently swirl (do not shake) until the solution is completely clear.
  6. 6Label with date and concentration (mg/mL) and refrigerate at 2–8 °C immediately.

Supplies Needed

Planning example for a 12-week protocol at approximately 200 mcg per day.

Peptide (10 mg vials)
Estimate vials from total mass: 200 mcg/day × 84 days.
Bacteriostatic Water
One 10–30 mL vial typically covers a full cycle.
Insulin Syringes (U-100)
One per administration (29–31 G, 0.3–0.5 mL).
Alcohol Swabs
Two per administration (vial + site).
Sharps Container
Required for safe disposal.

Protocol Overview

Goal
Model VIP anti-inflammatory and immune-balancing effects.
Schedule
1–4× daily intranasal.
Dose Range
~50 mcg per actuation.

Dosing Protocol

Standard
50 mcg per nostril, up to 4× daily (CIRS protocols)
Frequency
1–4× daily intranasal
Target
Per protocol, titrate up
Cycle Length
Protocol-dependent (often months)
Timing
Spread through the day
Route
Intranasal

Storage Instructions

Lyophilized
−20 °C long term (18–24 months); stable at room temperature for short transit.
Reconstituted
2–8 °C refrigerated; use within 4 weeks.
Light
Protect from direct light; keep in the original carton.
Freeze/Thaw
Avoid repeat freeze–thaw cycles after reconstitution.

Important Notes

  • Can lower blood pressure — start low and assess tolerance.
  • Most structured human use is within CIRS research protocols.

How This Works

VIP binds VPAC1/VPAC2 receptors to raise cAMP in immune cells, shifting the balance toward anti-inflammatory (Th2/Treg) signalling and down-regulating pro-inflammatory cytokines. It is vasodilatory, supports pulmonary and vascular function, and normalises several hormonal and inflammatory markers in CIRS research. Intranasal delivery provides direct access and avoids first-pass metabolism.

Potential Benefits & Side Effects

Reported in research
  • Broad anti-inflammatory and immune-balancing activity
  • Vasodilation and pulmonary-vascular support
  • Normalisation of inflammatory markers in CIRS protocols
  • Possible mood and energy improvements reported
Possible considerations
  • Transient flushing or blood-pressure drop
  • Nasal irritation (intranasal route)
  • Diarrhoea possible
  • Limited controlled human data outside CIRS work

Lifestyle Factors

  • Adequate hydration and 7–9 h of sleep are standard controls in most research protocols.
  • Consistent dose timing improves the reliability of any self-tracked endpoints.
  • Maintain a clean, sterile workflow for every draw to avoid contamination.

Injection Technique

  1. 1Tilt the head slightly forward and insert the metered sprayer into one nostril.
  2. 2Occlude the opposite nostril and sniff gently as you actuate the spray.
  3. 3Alternate nostrils between doses; do not blow the nose for ~10 minutes.
  4. 4Refrigerate the sprayer between uses and label with the fill date.

Frequently Asked Questions

Third-party HPLC testing

CG Labz Verified Batches

No published batches yet.

Research Disclaimer

All compounds are supplied strictly for laboratory research. Dosing figures below summarize ranges reported in published preclinical and clinical literature for reference purposes only. CG Labz does not provide medical advice or individualized dosing recommendations.

Peer-reviewed literature

References

  1. [1] Journal of Leukocyte Biology
    Delgado M. & Ganea D. Vasoactive intestinal peptide: an anti-inflammatory neuropeptide.
    View Source