CG Labz
Peptide Library / Recovery / Healing

TB-500

Thymosin Beta-4 Acetate Fragment

TB-500 (Thymosin Beta-4 Fragment) Research Protocol

Complete Research Guide 5 min read4 peer-reviewed references

Quickstart Overview

TB-500 is the synthetic 17–23 active fragment region of Thymosin Beta-4, an actin-sequestering protein found in nearly all mammalian cells. It is studied for its role in cell migration, angiogenesis and systemic tissue repair.

Reconstitution
Add 2.0 mL bacteriostatic water to a 10 mg vial → 5 mg/mL
Literature Range
2–5 mg per administration during loading; 2 mg weekly maintenance
Measuring Reference
At 5 mg/mL: 2.5 mg = 0.5 mL = 50 units
Frequency
2× weekly loading (4–6 weeks), then 1–2× monthly
Route (studies)
Subcutaneous or intramuscular; systemic action, site-independent
Cycle Length
6–12 weeks total

Scientific Data

Molecular Formula
—
Molecular Weight
4963.44 Da
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence Length
43
CAS
Research compound
Peptide Family
Actin-sequestering peptide
Half-life
Refer to published literature
Solubility
Bacteriostatic water, sterile saline
Storage
Lyophilized: -20°C. Reconstituted: 2–8°C, use within 2–4 weeks.
Appearance
White lyophilized powder
Standard: 10 mg vial · 2 mL diluent

Dosing & Reconstitution Guide

Interactive Reconstitution
Adjust vial size, diluent and target dose. Results update live.
Full Precision Calculator →
Concentration
5.00 mg/mL
Draw Volume
0.500 mL
Syringe Units
50.0 U
Doses / Vial
4

Units assume a U-100 insulin syringe (100 units = 1 mL). Larger doses mean larger volumes — a 1 mL syringe is often preferred over 0.3 mL.

Frequency: Twice weekly during loading phase

Reconstitution Steps

  1. 1Bring vial and diluent to room temperature.
  2. 2Swab both stoppers with alcohol and allow to dry.
  3. 3Draw 2.0 mL bacteriostatic water and inject slowly down the vial wall.
  4. 4Swirl gently until clear; TB-500 dissolves readily.
  5. 5Label with date and concentration; refrigerate.

Supplies Needed

Planning example for a 6-week loading phase at 2.5 mg twice weekly, followed by 6 weeks maintenance at 2 mg weekly.

Peptide (10 mg vials)
Loading 30 mg (3 vials) + Maintenance 12 mg (1.2 vials) ≈ 4–5 vials
Bacteriostatic Water
One 30 mL vial
Syringes (U-100, 1 mL)
≈ 18 total
Alcohol Swabs
2 per administration

Protocol Overview

Goal
Model systemic recovery, flexibility and angiogenic support in soft-tissue research.
Schedule
Loading phase (4–6 weeks) followed by maintenance.
Dose Range
2–5 mg per administration; 4–10 mg weekly during loading.
Reconstitution
5 mg/mL is standard; 2.5 mg/mL for smaller vials.

Dosing Protocol

Loading
2–2.5 mg twice weekly for 4–6 weeks
Maintenance
2 mg once weekly, or 2–5 mg once or twice monthly
Frequency
Every 3–4 days during loading
Cycle Length
6–12 weeks
Timing
Time of day is not considered significant for this compound

Storage Instructions

Lyophilized
−20 °C long term; room temp acceptable for short shipping
Reconstituted
2–8 °C, use within 4 weeks
Light
Protect from light

Important Notes

  • TB-500 acts systemically — administration site has no bearing on target tissue.
  • Avoid use in models of active malignancy; angiogenic compounds are contraindicated in oncology contexts.
  • Flu-like fatigue is occasionally reported in the first days of loading.
  • Human clinical data is limited to Thymosin Beta-4 trials in dermal and corneal wound healing.

How This Works

TB-500 reproduces the actin-binding domain (LKKTETQ) of Thymosin Beta-4. By sequestering G-actin monomers it modulates actin polymerisation, enabling cells to migrate more rapidly toward sites of injury. It up-regulates angiogenesis, down-regulates inflammatory cytokines (IL-1, TNF-α), reduces fibrosis by inhibiting myofibroblast differentiation, and promotes keratinocyte and endothelial cell migration. Preclinical cardiac studies show cardiomyocyte protection following ischemic injury.

Potential Benefits & Side Effects

Reported in research
  • Enhanced cell migration and wound closure rates
  • Angiogenesis and improved microcirculation in injured tissue
  • Reduced scar tissue and fibrosis formation
  • Anti-inflammatory activity via cytokine modulation
  • Cardioprotective effects in ischemia models
  • Improved flexibility and reduced adhesion formation
Possible considerations
  • Transient fatigue or lethargy during loading
  • Head rush or light-headedness post-administration
  • Injection-site irritation
  • Theoretical oncology concern due to angiogenic activity

Lifestyle Factors

  • Mobility work and active recovery complement cell-migration research models
  • Maintain consistent hydration; some protocols note dehydration-related headaches
  • Pairing with BPC-157 is the most common combination in recovery research

Injection Technique

  1. 1Subcutaneous abdominal fat or intramuscular deltoid/glute are both reported.
  2. 2Use a 1 mL syringe for volumes over 0.3 mL.
  3. 3Inject slowly — larger volumes benefit from a 5–10 second push.
  4. 4Rotate sites across loading-phase administrations.

Frequently Asked Questions

Third-party HPLC testing

CG Labz Verified Batches

No published batches yet.

Research Disclaimer

All compounds are supplied strictly for laboratory research. Dosing figures below summarize ranges reported in published preclinical and clinical literature for reference purposes only. CG Labz does not provide medical advice or individualized dosing recommendations.

Peer-reviewed literature

References

  1. [1] Annals of the New York Academy of Sciences
    Goldstein A.L. et al. Thymosin β4: a multi-functional regenerative peptide.
    View Source
  2. [2] Nature
    Bock-Marquette I. et al. Thymosin beta4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair.
    View Source
  3. [3] Expert Opinion on Biological Therapy
    Philp D. & Kleinman H.K. Animal studies with thymosin β4, a multifunctional tissue repair and regeneration peptide.
    View Source
  4. [4] Journal of Investigative Dermatology
    Malinda K.M. et al. Thymosin β4 accelerates wound healing.
    View Source